SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001314163.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001314163.1.44884
Domain Number 1 Region: 6-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.37e-85
Family ABC transporter ATPase domain-like 0.000000554
Further Details:      
 
Domain Number 2 Region: 238-357
Classification Level Classification E-value
Superfamily MOP-like 0.000000000249
Family ABC-transporter additional domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001314163.1.44884
Sequence length 364
Comment spermidine/putrescine ABC transporter ATPase subunit (plasmid) [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MSSSSLTVQKLAKRYGDFIALAETDLTVTEGEFLTLLGPSGSGKTTLLSLIAGLSRPDHG
AVMIGKTDVTYSAPHSRDIGVVFQNYALFPHMTILENIAFPLKMRKVGAEEARKRAQEAL
EMIRLPHIAQRYPRELSGGQQQRVALARCMVYRPSIILMDEPLGALDKKLREHMQLEIKR
IHRELGATIIYVTHDQEEAMTMSDRICLMNSGKIEQLGTPADLYFRPKTLFVADFLGESN
LLPATAGRSQGELMNVEIGPQRVAAQALANNEVSVGDAIHIMIRPQNLTIEKAEAKDRIS
AIVSDVMVTGSLTKIYMNAVDASLPALVAAFPTRLNGDQYRMGDKVALLWQGADAIAISE
KTRS
Download sequence
Identical sequences A6UKQ0
gi|150377568|ref|YP_001314163.1|NC_009621 YP_001314163.1.44884 366394.Smed_5470 gi|150377568|ref|YP_001314163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]