SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001325959.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001325959.1.44884
Domain Number 1 Region: 1-395
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.22e-68
Family Phase 1 flagellin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_001325959.1.44884
Sequence length 395
Comment flagellin domain-containing protein [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MTSILTNNSAMAALSTLRSISSSMEDTQSRISSGLRVGSASDNAAYWSIATTMRSDNQAL
SAVQDALGLGAAKVDTAYSGMESAIEVVKEIKAKLVAATEDGVDKAKIQEEITQLKDQLT
SIAEAASFSGENWLQADLSGGAVTKSVVGSFVRDASGSVSVKKVDYSLNANSVLFDTVGD
TGILDKVYDVSQASVTLTVNTNGVESQHTVAAYSLESLTEAGAEFQGNYALQGGNSYVKV
ENVWVRAETATAGATGQEIAATTTAAGTITADSWVVDVDNAPAVSVSAGQSVAGINIVGM
GAAALDALISGVDAALTDMTSAAASLGSISSRIDLQSEFVNKLSDSIDSGVGRLVDADMN
EESTRLKALQTQQQLAIQALSIANSDSQNVLSLFR
Download sequence
Identical sequences A6U644
366394.Smed_0265 gi|150395492|ref|YP_001325959.1| WP_011974475.1.31871 WP_011974475.1.61285 WP_011974475.1.7720 WP_011974475.1.89664 YP_001325959.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]