SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001327201.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001327201.1.44884
Domain Number 1 Region: 11-306
Classification Level Classification E-value
Superfamily Indigoidine synthase A-like 5.36e-116
Family Indigoidine synthase A-like 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001327201.1.44884
Sequence length 309
Comment indigoidine synthase A family protein [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MTNPSSSSLTIDYSDEVAAAKQRGAPIVALESTIITHGMPYPGNLDMARSVETIIREQGA
VPATIAVIHGVLHIGLDGAELEALSTTQGAMKLSRADLAFAIAERRTGATTVAATMIAAA
RAGIRVFATGGIGGVHRGAEQSFDISADLDELARTGVIVVCAGAKAILDIPKTLEVLESR
GVPVVTYDSENFPAFWSRESGLKSPLMLNSPAAIASFQRTRELLGIEGGMLVANPVPEES
EIPREEMEIYITRAIDNAASEGITGKAVTPYLLDNLFRLTDGRSLETNIALVENNARLAA
EIAVALAMK
Download sequence
Identical sequences A6U9N6
366394.Smed_1524 WP_011975675.1.29075 WP_011975675.1.61285 WP_011975675.1.7720 YP_001327201.1.44884 gi|150396734|ref|YP_001327201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]