SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001327741.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001327741.1.44884
Domain Number 1 Region: 140-284
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-45
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00021
Further Details:      
 
Domain Number 2 Region: 8-130
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-35
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001327741.1.44884
Sequence length 317
Comment UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MGIELLGFQTTIANPITLKGIGVHSGSEVEITFHPADADAGIVFQRVLAGGRLSEFRAVS
SHVGNTDLCTVLGLSPSTSIATIEHVMAAVYALGLDNLLIEVHGAEMPIMDGSSAPFIEA
IEQAGVHSLPEKRRYIRILKPVRIESGASWSEFTPYDGMRFEVEIDFDCPLIGRQSWKGD
MTPSVFKRELSRARTFGFMRDVERLWAGGFALGSSLENSVVISDDNTVINVEGLRYTDEF
VRHKTLDAVGDLSLAGAPFLGCYRSYRGGHRMNANALKALLSDPTAYEVVETATPRQRTR
PRDMVAVAAPGFAPWSA
Download sequence
Identical sequences A6UB76
WP_011976203.1.29075 WP_011976203.1.7720 WP_011976203.1.89664 YP_001327741.1.44884 gi|150397274|ref|YP_001327741.1| 366394.Smed_2073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]