SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001328922.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001328922.1.44884
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-33
Family Imidazole glycerol phosphate dehydratase 0.00018
Further Details:      
 
Domain Number 2 Region: 8-92
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.64e-32
Family Imidazole glycerol phosphate dehydratase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_001328922.1.44884
Sequence length 202
Comment imidazoleglycerol-phosphate dehydratase [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MADVTPSRTGQVSRKTNETAVSVALDVEGTGSSKIVTGVGFFDHMLDQLSRHSLIDMDIK
AEGDLHVDDHHTVEDTGIAIGQALAKALGDRRGITRYASIDLAMDETMTRAAVDVSGRPF
LVWNVAFTAPKIGTFDTELVREFFQALAQHAGITLHVQNIYGANNHHIAETCFKSVARVL
RTATEIDPRQAGRVPSTKGTLA
Download sequence
Identical sequences A6UEK7
gi|150398455|ref|YP_001328922.1| 366394.Smed_3263 WP_012067468.1.7720 YP_001328922.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]