SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001388286.1.17653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001388286.1.17653
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily DAK1/DegV-like 8.89e-83
Family DegV-like 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_001388286.1.17653
Sequence length 288
Comment DegV family protein [Clostridium botulinum A str. Hall]; AA=GCF_000017045.1; RF=reference genome; TAX=441771; STAX=1491; NAME=Clostridium botulinum A str. Hall; strain=Hall; AL=Complete Genome; RT=Major
Sequence
MVPIIFTDASCDLPRNFIDENNIPFLGLMCNFKGKDWEDDFGKTLSYEDFYTSIKNGEMP
STSQINEYRFEEKFKELLKEERPIIYIAMSSGLSGTVNSAKMAREEILAQNQEADITIID
TKCSSIGQGLLVYNAVKMAKEGKSKDEIVKWINENKNKVNHWFMVENLTHLRRGGRVSAT
SATIGTLLNIKPIIHIEKDGTLKNITSIRGKKKAIRYLLDRFKENCTNHEDVLIGIVHGH
CAEEAEKLKEMAREEFGVKNFIINELGIGMGAHCGDGMLALCFIANNI
Download sequence
Identical sequences A5I504
gi|153935499|ref|YP_001388286.1| 413999.CBO2573 441770.CLB_2514 441771.CLC_2445 WP_011986891.1.10598 WP_011986891.1.25111 WP_011986891.1.28409 WP_011986891.1.63111 WP_011986891.1.65258 WP_011986891.1.92266 YP_001255069.1.75347 YP_001388286.1.17653 gi|148380528|ref|YP_001255069.1| gi|153932384|ref|YP_001384815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]