SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001635843.1.55443 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001635843.1.55443
Domain Number 1 Region: 1-180,226-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-28
Family ABC transporter ATPase domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 771-1015
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-16
Family ABC transporter ATPase domain-like 0.0078
Further Details:      
 
Domain Number 3 Region: 486-569
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000000000000798
Family Rad50 coiled-coil Zn hook 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_001635843.1.55443
Sequence length 1032
Comment SMC domain-containing protein [Chloroflexus aurantiacus J-10-fl]; AA=GCF_000018865.1; RF=reference genome; TAX=324602; STAX=1108; NAME=Chloroflexus aurantiacus J-10-fl; strain=J-10-fl; AL=Complete Genome; RT=Major
Sequence
MIPLQLALRNFMCYRATENGDPLRLDLDGLHVLCLSGENGAGKSTLLDAITWALWGEARR
PDDDLITQGETEMMVELVFALDGRKYRVIRQRQRGRSSGRGTGAGKTWLDLQQFDGTTWR
PIGENTIRETQRKITELLRMSYTTFVNASFLLQGRADEFTSKTPAERKEVLAEILDLAEY
AELERRARERVRLLEADLIRVRGQLETLQPIANQVPFWQQAVAEAEQRQHTLQQQRTALE
AEFTQASEKLRHLEQEAHRQREVQNRIAILTGEIQRYSNELRELNARIAQAEQTIAQRPL
IEAGLAELHAARADLERLEQLRTRYDELMARKRELQQELKAELNLLNERLSHAIQQLDRL
YAEAQRLVGLQQRVAAIRQRLRELAPVHERLVQCQHQRTALEQHLNHIRDLVMRQRLLQN
QLEQQRNTLQSELNRSHQELARLDRQLSDVETWRNALRAAQDAQARVQILEAEQLNRRQQ
EQVVLDRLSAARAEAAQARRDIETLQTNQALLATGKGECPVCRRHLAANEADHVYAHYRQ
ELERLQAQETQAKAAIQAAEQELKQIRSTLTSTEQELTRLRQQAATIESLHHQLNQAATW
QTERDQLAQRIATLTGQLTTGSINPAVQAELDTLITDLEAAGDIESVQRDLRMLNDEMMT
LEQQLREHSRLEGELSTCQNDIERIEHALRDLPAAEATVAELQRQIAENDFGHEIRVAGR
QVVAELESLNYRPEDLEATRALVRSLTRWEQAERDLLLAEQRYATDLKLREQTQQLCDHA
ERERQTLHAEAEALAHQLRVLPTVQATVNQVKQQLSANEQALQAAGRDLAEKQAYYRQAE
SAAAEVESLQTQERQLSERTALFAELAEAFGKKGVQAMLIETAIPQLEDEANRLLARLTD
GQMHLRFEMQRDTKKGDTVETLEVRIADALGTRDYAAFSGGEAMRVNFAIRMALSRLLAH
RAGARLETLVIDEGFGVLDADGRERMVEAITAVQRDFARIIVITHIDDLKDRFPATLEIR
KTPLGSRWELRG
Download sequence
Identical sequences A9WFV4
324602.Caur_2245 480224.Chy400_2419 gi|222525668|ref|YP_002570139.1| gi|163847799|ref|YP_001635843.1| WP_012258108.1.35445 YP_001635843.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]