SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_002248172.1.25208 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_002248172.1.25208
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000109
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Weak hits

Sequence:  YP_002248172.1.25208
Domain Number - Region: 99-125
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_002248172.1.25208
Sequence length 165
Comment serine/threonine protein kinase [Thermodesulfovibrio yellowstonii DSM 11347]; AA=GCF_000020985.1; RF=reference genome; TAX=289376; STAX=28262; NAME=Thermodesulfovibrio yellowstonii DSM 11347; strain=DSM 11347; AL=Complete Genome; RT=Major
Sequence
MKKILYIAGAIFAGFLAGYLSLTLFVSGGTIEVPDLRGKDIVQANQILKEKGLYIRIDGE
EYSDIPTGTVSRQSLPAGTKVKKGREVGVIMSKGLKFTVFPDVRGVSYEEAEKILNEKGI
PIEKVIKIHSNKYPDNIVIAQSPEPQQGGKAIKLIVSIGEKEEEK
Download sequence
Identical sequences B5YIL3
gi|206890406|ref|YP_002248172.1| WP_012546118.1.25233 YP_002248172.1.25208 289376.THEYE_A0325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]