SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_003153557.1.138 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_003153557.1.138
Domain Number 1 Region: 82-308
Classification Level Classification E-value
Superfamily MetI-like 3.14e-54
Family MetI-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_003153557.1.138
Sequence length 320
Comment carbohydrate ABC transporter membrane protein [Brachybacterium faecium DSM 4810]; AA=GCF_000023405.1; RF=reference genome; TAX=446465; STAX=43669; NAME=Brachybacterium faecium DSM 4810; strain=DSM 4810; AL=Complete Genome; RT=Major
Sequence
MTFGRDSGGGAQPGPASTPRRRGGRGHPHRPSAVARSAATPYLFILPALLVYGAFALYPL
GRAAQFSLFEWKGFGSSTFVGLRNYLDLAGDADFRAAIGNALVLIVFYAVIPLVVGLVLA
AILRRGQVRGLGFFRTVIFLPQVIALVVVAVAWRQIYAPSGLLNEALRTLGLGALTRGWL
GDPSTALAAVGFIGTWVQMGLVMLLLLSGMSRIPGELYEAARLDGAGAVREFFAITLPSV
RGEITVSLVLTIIAALKTFDLVYMTTSGGPGNTTTVPSFEVYFRAFELRAVGSASAVAIV
LTALIFVINVGVTRIGERQS
Download sequence
Identical sequences A0A1X6WYH4 C7MF67
YP_003153557.1.138 446465.Bfae_00850 gi|257067302|ref|YP_003153557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]