SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_003153884.1.138 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_003153884.1.138
Domain Number 1 Region: 17-186,269-376
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-56
Family FAD-linked reductases, N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_003153884.1.138
Sequence length 510
Comment 2-polyprenyl-6-methoxyphenol hydroxylase-like oxidoreductase [Brachybacterium faecium DSM 4810]; AA=GCF_000023405.1; RF=reference genome; TAX=446465; STAX=43669; NAME=Brachybacterium faecium DSM 4810; strain=DSM 4810; AL=Complete Genome; RT=Major
Sequence
MPRSAAPDLPATDVLTTDVLVAGAGPTGLMAGLVLARRGVRALVIDPKPGPTRESRAIVV
QPRSMEIFDQLGLADAVLDSAQLTLQLQIRGGQSPVGADFFAQQQGLTPFPGVQIFEQSR
TESLLGTALAADGAPVLHGHRLVSFTAEAGVEALVEGPEGPLRIRSRFLLGADGASSPVR
HQLGLDFAGVTDDATFCVADLHGVEGAPEDAISVRFGRERFALLFPLGPGGHARLIWLHG
ETHPEQETALAGARQDLGIRYEDVAWFSAYRVHHRVASRFRAGPVMLAGDAAHVHSPVGG
QGMNTGLQDAHHLANLLADVLSGRREERELDRYERERRPVALTLIGATDRAFGIIARTGR
GTALLRRRARHVLALLAPRLLATRFGPYAGGLLGQYRIRYHPVDAGEPAPRWARDRAVGR
RLRPTAENRDALRAMDWQLHSYGTDAARPAVPDWIHGPLVFPPDPAGQLRDDRLYLVRPD
GFVAAAFPLHAGAAAVADVDEALAAYAVVR
Download sequence
Identical sequences C7MGV3
446465.Bfae_04210 YP_003153884.1.138 gi|257067629|ref|YP_003153884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]