SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_003156130.1.138 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_003156130.1.138
Domain Number 1 Region: 25-239,331-386
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-35
Family FAD-linked reductases, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_003156130.1.138
Sequence length 388
Comment glycine/D-amino acid oxidase, deaminating [Brachybacterium faecium DSM 4810]; AA=GCF_000023405.1; RF=reference genome; TAX=446465; STAX=43669; NAME=Brachybacterium faecium DSM 4810; strain=DSM 4810; AL=Complete Genome; RT=Major
Sequence
MNSLPASSTSAAGLSRGSSAAPESVIVLGGGALGASIATHLAQAGASVTLATAGELCDGA
SSRSLSWLNSAGDRSPAYHALRVHGIDRYRTLFAADPSCEWLRFSGGLWWGTDASSAATH
DRHAGEIGRGYASELLDRGEVARRFPDLDTGVIAPEAIVNPGEGWVSLPHLVEHLAAKLR
DLGGTITTGLGPCSLIVEDGRAIGIRDQRGAEHRAGAVVVACGAKTPAVMNRAGVDIPDG
SPLSMMVTTDPVDAEAPVMNTPRAAVRPNPGGSFCVDHDWYVGDIVEHEDGTCTIDESIV
AELLEEASRLFAGGVSLTAARWAAGRKPIPGDGEPVLGAVGALPGCYVAFTHSGATLALI
AGEMVTHEVMTGNRHPMLASFSPDRFAS
Download sequence
Identical sequences C7MHM3
gi|257069875|ref|YP_003156130.1| YP_003156130.1.138 446465.Bfae_27740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]