SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_003156269.1.138 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_003156269.1.138
Domain Number 1 Region: 39-320
Classification Level Classification E-value
Superfamily MetI-like 2.52e-57
Family MetI-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YP_003156269.1.138
Sequence length 320
Comment carbohydrate ABC transporter membrane protein [Brachybacterium faecium DSM 4810]; AA=GCF_000023405.1; RF=reference genome; TAX=446465; STAX=43669; NAME=Brachybacterium faecium DSM 4810; strain=DSM 4810; AL=Complete Genome; RT=Major
Sequence
MTTTPSPSPSVAAQTAPAVLPPAGRKRAKPAQRPLTRGEKGFRVINVIILSGFALLCVIP
FVHVIGSSFATPGELATSNFLLVPREFTLDAYRYILSTPTIFRAIGVSTIVTVGGTFLSL
LVTALMAYALAKPRLVGRRVINFMVVFTMLFSGGMIPTFIVVSKLGLLDSLWSLVLPVLI
NAFNFVIMRNFFSGIPESLEESARIDGCSELGVFVRIVLPLSIASIATIGLFYGVTYWNT
YMHAVLYINDSSKWPIQVLLRQIVIVASGVNADAGAVDVVPPAQSVKMAVITVATLPMLM
VYPFIQRYFVKGALIGSVKG
Download sequence
Identical sequences A0A1X6X1P1 C7MA09
446465.Bfae_29180 gi|257070014|ref|YP_003156269.1| YP_003156269.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]