SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_008771058.1.9325 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_008771058.1.9325
Domain Number 1 Region: 42-104
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000785
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_008771058.1.9325
Sequence length 113
Comment hypothetical protein BigBertha_31 [Bacillus phage BigBertha]; AA=GCF_000912355.1; RF=na; TAX=1406781; STAX=1918006; NAME=Bacillus phage BigBertha; AL=Complete Genome; RT=Major
Sequence
MDGLIINGCDVYKAKSRTTNMGDLVEMFINENFEHLSTVMYEKLEELAKDIEEQARELDD
QYDDLESRARELEESYDELCGEVSDLEEQVGELEEENEQMKQTIESYLGEGEF
Download sequence
Identical sequences U5PRQ8
YP_008771058.1.9325 gi|568191271|ref|YP_008771058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]