SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_00025 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_00025
Domain Number 1 Region: 153-510
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.87e-22
Family Cystathionine synthase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_00025
Sequence length 571
Comment | SNOG_00025 | Stagonospora nodorum hypothetical protein (572 aa)
Sequence
MTQPYPTAVANPNRVLSQRTHTKPSESPRLSMVETWSILLSQLKATTATIKQRYDERAQI
ENEISARTDDWCINIFLETYKRLDQLTAELEMQLAITQNCGLNQASSALSTFTLSPWQME
ERYRALIQMQSYLGSFFERASPAYDQSQTVWCFDPSYHRSDGLNYDRYGAADVRKSEARL
LKALGLGSEQIPLKLLLTSSGVAAFTVLHQFLMSKVLSAGDTIVISPYLYFECFEHLRLV
SHVRVINTDTFDAEDIIATAERHNAKAVYLDPMANTLGLQTTDIRRFAQLLSGREGWSDR
YLIIDGTLISGGMQLYDWFNEPSHPKVLYYESAHKYIQMGMDVVMCGLMVYPEELHSPIG
LIRQVTGTTLYSRQANVLPPINYDIHQSRMNWLTTNAEKLYHILDRQCSTIADFNFPIHW
RKLGWSHGGNVVTIRLLGDQMNKRASLDAFTALVLRAAEEESVGMTKGGGLGFSVTRIWP
STPFIRNEDPYMRISVGVDSDEVEAVARAIQKGLERHYRNSRSAMALWKLRENGPIQANG
IGLVKANGNGFVAANGNGAFKTNGNYFDAGR
Download sequence
Identical sequences Q0V7I9
XP_001790723.1.30160 SNOT_00025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]