SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_00379 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_00379
Domain Number 1 Region: 105-286
Classification Level Classification E-value
Superfamily TPR-like 0.000000155
Family Tetratricopeptide repeat (TPR) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SNOT_00379
Sequence length 301
Comment | SNOG_00379 | Stagonospora nodorum hypothetical protein (302 aa)
Sequence
MSSGGRYDEAIATLEAIDANTHKSLKYHQYLVLCTGVIKFKRAIRRSNWAACAHLLNTVQ
PQPAADPSSTPLDPELSFILHEAHVDYLSSRACYSEAFIATSSLARSFKEDNADVLQRVS
VLLMKGDLFRKVGRPERGFSAAIRAASVSYKAKLMPSLWAAIGLLANILNDLGQSTSARR
LLEGVIPQAIEGTDSYLLGILYSHLGDAYMGLADPSPKVNAETSVPSNPNRWTARHVAKA
ELYTDRARECYKKTGYLAGECEQLMKKAVIAKLRGDEKLAEEWAQNHNRVWEEGMMDMED
G
Download sequence
Identical sequences Q0V6I5
XP_001791066.1.30160 SNOT_00379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]