SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_01132 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_01132
Domain Number 1 Region: 57-134,165-458
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.71e-70
Family GABA-aminotransferase-like 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_01132
Sequence length 461
Comment | SNOG_01132 | Stagonospora nodorum hypothetical protein (462 aa)
Sequence
MDKFHSHRTGTPLLTVTACVCRPFNRLSHVTVTPTRAVPSSAHGQPLCMSTTLARCPAPL
PTTVLEKASQALLNYKDKGIGLCEISHRSPEANEILADCKHALSTLLSIPDDYEILFLQS
GGSGEFSATVYNLVSIWVEKKRAKIAEEVGDDKDEVLRRLRRVVDEELKLDYLVTGSWSL
KASQEAARLVGAKHVNIATDARKISHGKFGNIAPEDQWTLTPRSAGGPAFVYFCDNETVD
GVEFPSFPKSLEGEDAPLVCADMSSNFISRNVDVSKYAVIFGGAQKNIGNTGIAIVIMRK
SLLPPHSTPASPDLLRELNLAVGPIVLDYPTIAKNNSLYNTLPIFDVWVAGQVMSGLVNS
FGAKRIGGQEEISNEKARLIYEAIEKYPSVYRVVPDKSVRSRMNICFRVGGGDADKEKAF
LAGAEKKGLLGLKGHRSVGGIRASNCAKLLVSYLEQFAESA
Download sequence
Identical sequences SNOT_01132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]