SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_01821 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_01821
Domain Number 1 Region: 87-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.98e-85
Family GABA-aminotransferase-like 0.0000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_01821
Sequence length 513
Comment | SNOG_01821 | Stagonospora nodorum hypothetical protein (514 aa)
Sequence
MASLLRTAGRFRPALINSNAPRAVKVAPVALRRRYASAAAAAVMPDASEQPFFPDEPAGP
IVQTQIPGPESKKAVERLSKVFDTRSLNMMADYSRSYGNYIADLDGNVLLDVYAQIASIP
VGYNNPALLLAATSPEMASAIINRPALGNFPQHDWADILESGILSVAPKGLNQVFTGQSG
SDANELAYKAAFMWRRQQERGGADVDFSAADITSSMDNKSPGAPDLSILSFKSGFHGRLF
GSLSTTRSKPIHKLDIPAFDWPQAPFPMLKYPLEEHVRENAEEEKRCLAETERILTTFHH
PVAAIVVEPIQSEGGDNHASGSFFRSLRDMTKRLNILMIVDEVQTGVGATGKFWAHEHWN
LSTPPDMVTFSKKAQTAGYYFGNSELRPNKPYRQFNTWMGDPARAILMRAIIGEIERLDL
VRHTAATGDYLFEGLQRLSQKFPNDVQNLRGQGQGTFIAWDCPRRDEVLKKAKAHGVNIG
GSGEMAVRLRPMLIFQRHHADMLLERLERIFAA
Download sequence
Identical sequences Q0V2E3
XP_001792446.1.30160 SNOT_01821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]