SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_02205 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_02205
Domain Number 1 Region: 34-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-99
Family Pyridoxal-dependent decarboxylase 0.000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_02205
Sequence length 479
Comment | SNOG_02205 | Stagonospora nodorum hypothetical protein (480 aa)
Sequence
MVHINRVATTKEVNDEKSQFESAPESKINLHPDDDADDYTATVYGSRYAEEDLPRHEMPD
KEMPPSVAYRLIKDDLTLDGTPTLNLASFVTTYMEEEAEKLMVDAFSKNFIDYEEYPVSA
DIQNRCVSMIARLFNAPSEDDSNTIGTSTIGSSEAIMLGVLAMKKLWQNKRKAEGKPFDK
PNMIMNSAVQVCWEKACRYFDVEERYVYCTTERYVIDPKECVDLCDENTIGICAILGTTY
TGEYEDIKGINDLLIERNIEVDIHVDAASGGFVAPFVNPGLLWDFRLPKVTSINVSGQII
GQYYQLIRLGKRGYRRIMLNLTRTADYLSANLENMGFIIMSQRGGEGLPLVAARIDEDLG
KQYDEFAVSAHQLRERGWVVPAYTMAPHSEQMKMLRVVVREDFTKSRCDALIADFKLALQ
TLDSLDAKKLQEHKEHQFAMRRRSTLTTPIFSKGKKANNPFVDEDHSLQGKTGKTHAVC
Download sequence
Identical sequences SNOT_02205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]