SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_02814 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_02814
Domain Number 1 Region: 73-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.17e-61
Family Cystathionine synthase-like 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_02814
Sequence length 489
Comment | SNOG_02814 | Stagonospora nodorum hypothetical protein (490 aa)
Sequence
MDASAAISQLRQGQKPEWPQNANTSDFAKTLDNSSEFPKTLRHEYVVPTKAQLKRKTLND
DAQTAAKASSSDDEGIYFCGNSLGLQPKAVGEYLNAYLKTWGSIAVGSHFTPMADSPLTP
FQDMAAECARRMSDIVGASPSEIVAMNTLTINLHLMMAAFYKPTEKKHKIMCEWRPFPSD
WYAIESQIEWHGLDPKKSMLLVKPDDGYLMTTESILKLIDQEADELALIMLPGIQYYSGQ
LLDIPTITTHARKHGITIGWDLAHAAGNVELKLHDWDVDFACWCTYKYMNAGAGAIAGAF
VHSKHGDNGSNVGLKGWYGHDKSSRFLMDNKFVPTPGAQGFQCSNPSAVDLTCLAGSLSV
FQKTSVADLRSRSLLLTAYAEHLLTQIASRNIKDGNFPFQIISPLDPRFRGAQLSVLLQE
DVMEEVFAGLEENGVICDKRKPGIIRVAPVPMYNTFEDVYKFMHILEGALQPKAEQKTQA
HGEAVEARL
Download sequence
Identical sequences Q0UZK0
XP_001793409.1.30160 SNOT_02814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]