SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_04259 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_04259
Domain Number 1 Region: 133-180,221-597
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.13e-74
Family AAT-like 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_04259
Sequence length 604
Comment | SNOG_04259 | Stagonospora nodorum hypothetical protein (605 aa)
Sequence
MDNVCLKRLFAAFLIPSIISSPTSPASTLPSTTQHKELTKREDWKDLSPLRGFAITPRTE
SKQNMAPPSAIEVSAETDTSGITIPNPLTAPITSNDIFGRRKKALQSQWGIAAASDTANF
RQKSYENKPKAKRWDHILSQEALIRKGNSLKEAAKFLATPGLISLGGGLPSSEYFPFEEL
SMRVPQVGHFSEAETKESGVLIKAGKHDLADGKSIFDIATAFNYGQGAGSAQLLRWMTEH
TELVHNPPYEDWRCCMSIGSTSALDMALRMFARPGDVVLSEEYTFSAFVETARPMGVRVC
GIPLDAEGLIPEQLDNILSTWDVNVRGARRPHLLYTVPTGQNPTGATQSAERRRALYAVC
QKHDIYIIEDEPYYFLQMQPYTGPNAPVVPPPSSHDEFLNSLVPSYLSMDVDGRVMRLDS
FSKVVSPGARIGWVTACAEIVEKYTKHADVSTQNPSGMSQLILFKLLEDHWGHAGYLDWL
IHIRMQYTKRRDVILQACTKYLPTEVMSWKPPMAGMFHWMQIDFKKHPQYPEKSIEEIEE
SIFYRNIEHGTMCMRGSWFYADADEEHDTLFFRATYAASPEDKMEEGIRRLGESVREEFG
LGKK
Download sequence
Identical sequences SNOT_04259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]