SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_07702 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_07702
Domain Number 1 Region: 35-93
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000746
Family Pyridoxal-dependent decarboxylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_07702
Sequence length 132
Comment | SNOG_07702 | Stagonospora nodorum hypothetical protein (133 aa)
Sequence
MAGLARHVDPDELMKTLHDHPMHKAAGGRRNQTVSHITPYSSRYSASTELSKFKIPHDGA
PADVVHQLLKDELDLDGRPSLNLASFVGTYMEKDNFASPSPFLSTSPQEKRGPAVSTTPY
VIHHHDYASMRN
Download sequence
Identical sequences Q0UKL2
XP_001798034.1.30160 SNOT_07702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]