SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_08153 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_08153
Domain Number 1 Region: 187-308
Classification Level Classification E-value
Superfamily TPR-like 0.0000000058
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_08153
Sequence length 366
Comment | SNOG_08153 | Stagonospora nodorum predicted protein (367 aa)
Sequence
MAAPAVSTTCPPKTSASSRTRPHTITCPPRPSPHPSSTPRSLPSPSIPISTLLLSGHYRL
ATSLCTRNILSCSPHDHQTLFHLFHTRLACLCLLGEHALAAQESKLLGDLNSAFYRHPLT
NAHLVSWDLRVLAVRLSALGYGEWRKGIMGYYELARECRENIVKASTSEDEKKTWRARLR
DCGIRVANVLVEMGDLEGAGRHLSTLSTDEGDVDKDIAIMETLVWLRVGDIAAARRCLSS
ATSSTLTNATLTALLHLADSDFEAATTAFRALYDEHPDDAMVAQNLAVCLVYTGRISEAK
TVLETLVDQSAPFHSMVFNLSTVYELCTERNRDRKMSLAGKLAARKDGGGMGWEMSASEF
KLAPVA
Download sequence
Identical sequences Q0UJB1
SNOT_08153 XP_001798478.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]