SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_08544 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_08544
Domain Number 1 Region: 537-647
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000114
Family Tetratricopeptide repeat (TPR) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_08544
Sequence length 654
Comment | SNOG_08544 | Stagonospora nodorum hypothetical protein (655 aa)
Sequence
MAASETTPLLEQQDSQEDPGTYFTDEDNTESTAVHRGTFARNLGALDGFALLISIVIGSG
VFSSPGPIDANVPSPGAGLLIWLLGGILAWTGALTMAELGTAFPGEGGIQPYLSYIYGDV
WGYMAAWSWIVATMPATLAILSIVFVESIYSSMGINEPSPPLTHKLLSVLVLICVTTLNS
ISTKTSTRLSSFFVAIKLLTILLLIVAGLVVVFVYVGKSKDYGGGDWHSKGWFAPRDTVL
PDGTHFDWTELSTWESLGFYSTALYGALWAYSGWDKANYVAAELRNPSRQLPLSINTAIP
TIILCYVAANAVYYVLLPWEVVSTTDAAAVTAVTHFLGKGVAYFATALICLVIAGSALGN
SFVAGRMTVAAANNQWIPQFLGTVGQIGTFKLTKASEQSESAEDAMDQGESPINALILNT
VLSTIYILLGNMRILLTLNGLAEYAFFFLTVLGAIILRFREPSLPRPVKPFIAIPALFAI
ISGFVVVRGAVFAPIQAAVLVGIWVIGVVFYYVRLFISSRKRATTWCDPSETSEWNRNIV
IALRNSGHHAQAILYFERALWVDPNNMVARAGLSKTYFFMGEYMAVITYGPETLLLLGRA
KYNGIADQYTHAHINEELPFTYADLASAHRRLEELEKALHDYEQAVKTGMTGTV
Download sequence
Identical sequences SNOT_08544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]