SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_10845 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_10845
Domain Number 1 Region: 313-333,380-601
Classification Level Classification E-value
Superfamily HAD-like 7.94e-42
Family Meta-cation ATPase, catalytic domain P 0.001
Further Details:      
 
Domain Number 2 Region: 125-215
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000000379
Family Calcium ATPase, transduction domain A 0.0031
Further Details:      
 
Domain Number 3 Region: 53-115,217-300
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000562
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SNOT_10845
Sequence length 609
Comment | SNOG_10845 | Stagonospora nodorum hypothetical protein (610 aa)
Sequence
MAETATYVNPQTCRTGILWLAGFVQFGFGLPFYEKAIAAMRNTGLLYLPMDALIAASTTT
SYIMGLKSYFLGKDVHYATTAATLIFVISLGRYVGEMFRTSSAPTIAAFSNIVPSEARLL
HSPTPVSSHTLKPGDFVVVEAAHRFPCDGRLVAYPNQFQTLNLNIDESIHTGESILVKKV
WGDICLAGTINSHSQEIIIEVIEGGRNRLDQILDAVLEAQLQKSDIQPWLDQVSEYMVSC
VMFCAFIAFLVWLPDGFDTAATFFSTTLIVACPCAFGLSVPAMTMIACSLGAAKGVVVRA
GVQAFQKSSTVTTIVFDKTGTLTTGDINVVHYKIHGRWEEPVWWQVIGEAEKRSRHWTST
VIAKYIEVHHPRSVSMSLSKSKPQEAPRETPGSGVTADVDEVKVVVGNEQYLRNANVQNL
DTLMNDVETLSNTHSCTFVGLNGRYAGFIAFSDPVRDDANKEIRALKSQGYEIYMMTGDR
TEVAKEVANAIGIQNVFAELTPVQKSDKIKRLRKEGKVVAMIGDGINDTAALAASDIGIS
LQSCHSVVLASSDIVLLTSSLRMVSIAFTLARNANAAIKGSIFWAALYNFTLLPLAMGAG
ARWNIIMTP
Download sequence
Identical sequences SNOT_10845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]