SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_12023 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_12023
Domain Number 1 Region: 77-502
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.93e-71
Family GABA-aminotransferase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SNOT_12023
Sequence length 508
Comment | SNOG_12023 | Stagonospora nodorum hypothetical protein (509 aa)
Sequence
MDLHEVQDATARFFNDVNAQFQRIPGSAIAVRYIKSSYQNDPVRSAIELFLFLFAVRYLL
APKYSTQKKVQLTDAEIDELVEDWTPEPLVAPPTAHEELDNEKRPVIVGPTGPKSKLSNG
RTVMNLASYNFYNFVANESLKEKAIQTLRTYGVGPCGPPGFYGTQDVHMKTEADVAAHLG
VPACIIYAQSFSTISSVIPSFSKRGDIIVADKAVNYAVRKGMQISRSTIRWYEHNDMEDL
ENVLKKVVKEQAKKPLTRRFIITEGLFENIGDVVNLPKLVELKLKYKFRLILDETWSYGV
LGRTGRGVTEAQNVDAAEVDMIIGSLSGPLCAAGGFCAGNEEVVEHQRISSASYTYSAAL
PALLSTTASETISLLQEQPDILMTLRENIKAMRAQLDPRSDWVKSQSASDNPMLLLTFKP
EVVEAKKLSVEDQNQILRDVVDECLANGVLITRLKAFPLGLGVNPRDAGWQPQPSLKVCV
TSGLTKKETEKAGTVIRHAITKMISRRK
Download sequence
Identical sequences Q0U891
SNOT_12023 XP_001802255.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]