SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_12441 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_12441
Domain Number 1 Region: 16-63,96-478
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.28e-69
Family AAT-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_12441
Sequence length 487
Comment | SNOG_12441 | Stagonospora nodorum hypothetical protein (488 aa)
Sequence
MSSGISHKVLNLDNINPHVRAAKYAVRGELAVKSEEYRAKLAKGEGKDLPFDTVIAANIG
NPQQLDQKPITFFRQVASLLENPGLLEHENVLIDSLGYKSDVIARAKKLLKEVKSVGAYS
QSQGAPGIRQSVAEYIERRDGYPASFENIYLSNGASSGVNTLLHTICAKPETGIMVPIPQ
YPLYTATLSVLDARVVPYYLEEDQKWGTSMDAIRTAYDKAIAEGTDVKAICVINPGNPTG
ASLPAEDIKAVLKFAAEKGVVVLADEVYQTNVFIGEFISFKKALRDLQKAEPGKYDNIEL
ASLHSVSKGMVGECGHRGGYFELLGFDPEVAAEVYKFISIQLCPPVLGQCIVEMMVNPPK
EGEPSYELYKQEYDTIFAGLKKRAYALYEAFKRMEGVECDEPQGSMYLFPTIKLPQKAIE
QAKKEGREPDEFYCFRMLDATGVCVVAGSGFGQKEGTLHFRTTFLAPGTEWTNRLVKFHE
DFMAEFK
Download sequence
Identical sequences Q0U723
SNOT_12441 XP_001802664.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]