SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_14271 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_14271
Domain Number 1 Region: 1154-1375
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000183
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 2 Region: 932-1154
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000438
Family Tropomyosin 0.0025
Further Details:      
 
Weak hits

Sequence:  SNOT_14271
Domain Number - Region: 1352-1559
Classification Level Classification E-value
Superfamily Tropomyosin 0.000281
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number - Region: 729-914
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SNOT_14271
Sequence length 1927
Comment | SNOG_14271 | Stagonospora nodorum hypothetical protein (1928 aa)
Sequence
MKRDALPLDDFLDAGHFGQSWHMPDDEMARIQLAGTKSSLMRDVTLRKGNWDMGWNTFAL
YTVLSQKTHHALPRAQSNRRTAGLVMTTGGWRPRCGRVFQDLVQALSRPHNRESMLGRCV
ACGYWLTHDPTCPLVLQTKIVPRAQGRCRNTANLDFRILIPEWSRSMRSDHHDTSAPCES
ESRVAASASASASASALARPPATIPTAKFFEKIQGHCSAPAHDYFAAEHNNGTMASHLRP
PDASDARPNAPSRARSAVENLLPAGIVRRSSARPPATPHMERSISSMADSFTDYWGVCAR
NPDPEGSKTPEPPVQEDELKPISNWAHLTYMKNQRNNLRAELKAHQIAGAEAKRSVASLR
RLAFRMAVNISAKERQIATSARNLANSRQSRYVEGRDAEKRVDALKRALRVEEGRNREIL
EALERASMLTLQYANPPEAQQRPPRPPRNPLSPPPSPPTRLSNLAMTTLSTPQTPPRSTS
SSWNETDWELTPGLASPTEVRTSDSRLIRAKRESDQALSACRRRISELQAECAKTKEDGE
ALEESKNGLQGDIQEQQERIATLEAARAAIEETLESTRLQLEVSTGLEESLKQKLRMKNR
ELASLEQSSEGRQAELEGLHEEKDSLVSQLAERDAQLQELEARTTSLQETLTTLQNKLQA
AERNEASLQDQLKEKDLANEDLKKRLDRGSKYEQILQKKIAEHEQEILGNVKKIEVGGGL
ISALRAQMKQSESSKKDAEDALTTLRTELSGLKSTQAKDVQVREALSLELDDTQSARNKM
QKELSGTLESLSRVEAEKQSLQSELDSLQSSHDTLLENLRAAQRHIHTLELSDEQQAELE
MLRDEKASVEADLRVARQTNFSLREAQRMSKSDLKELRASVKDLQQQLHESHERETVLKT
QLDLAHGAQAEVERQQEEESQRHSEEHRQLQLSMTSLHASLEASEKLKASLQEELRQLQS
ANIDLDKQFHDTLRSKADLQNELDTVRTKLEHSTSHSNGLRTKLDELELDLNASRQSKVD
VEAQLGHVHKQHESLATRISELEQFLCESRDDTSRAEKELRLKQESSEASATEVAELRET
LHTTETSKMEAEAKLSLAISLQNDLESQLQIAQSRSAELQTEANSVQARLSTMEGEAAQL
HRSKEELTEQLQASHHAQTEMQEQLKSTELRLHAVETEVTGLKSRVAAGQQELENARLSK
VEVENKLEQALQSHAQVEEELSAARGSNAATEALETDLALARSQYNELEKAHSEMISQSE
MSEEELGTLRESRSDAERKLEDALSSTKSLEHELELTVGKLRDFESKHASLVTRIESTEK
ALASTRDEKAQLEQSSSSTASDFASVQMRLTDLESEKESISTEAKEIRQREESLRETNAK
LEQQLSDATQHASDLKNDLHAARARLETAESENATLKSRISEADENLSSLRETNATLTAS
EKDLHERLESAEENLQAVRETNKRLEAFLERVEADMQHAETAFEESEKRLEEFVEESQAK
LDAARDAKLKYKRRLSERNNEIELLTTENSHLQQQIGEKREEVNALAKGKEEMQEQLEQK
DKFVSDLRSSSDRRMKSMNLAYNELRTRYEERVSGHPGARPKRDRAMTEIRKPNKEELAS
AYAALEREVEGLRKDKKTFENLVSTLQDKISQLQRLEEWHDAREPEVRLEADSTPSTPTT
QHSGSRVGSTFSRSPSIAINDRPTTGLSTASKQEWANDIERLRMLRNEQANQLKSNKKAR
SDLRKSLKESKTMLHQLEKAKQQKSSRPRAFLRKSRPSTANMLDTTDQQDYTSPTSPSTP
SRPATSHAFLTPDTARTGTPFSTPDRAQTTTPFASARSRHTIHFAPDSDPVEHPQPSTSP
LSARPHTPHRWSTLVRPKSRQRPSTSGGLLEGTVQNERPTTSAGERMLGGDKKADKRRSW
SLRKLFK
Download sequence
Identical sequences SNOT_14271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]