SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_15419 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_15419
Domain Number 1 Region: 356-543
Classification Level Classification E-value
Superfamily TPR-like 7.59e-26
Family Tetratricopeptide repeat (TPR) 0.0071
Further Details:      
 
Weak hits

Sequence:  SNOT_15419
Domain Number - Region: 302-383
Classification Level Classification E-value
Superfamily TPR-like 0.00341
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SNOT_15419
Sequence length 623
Comment | SNOG_15419 | Stagonospora nodorum hypothetical protein (624 aa)
Sequence
MSSLSPADEAQLKAQLQDAVVACTERCLYHSAKWAAELLNSLPASEDDASDTDVDSPMSE
ALPPHTPNPAPKDAIEQRLEAREAHKYLLAKTYFDCREYDRCAAVFLPGPLPKAHAHATP
TSPLAKNKHAAKGKAKTGTPTKTKFQSESVAGLSQKSLFLALYAKYIAGEKRMNEDSEMI
LGPQDGGVTLNKELPGISAILEEWFKALPASGRQPQGWLEYLYGIVLAKGKNEKLGQGLP
HPEHPSELMALLHTIEDLGEVVPLLPQNLMAFIFHVHASQELYAVTDSVHTQLSQILSIF
PEDFDDAEQIFSDLLISDPHRVDHLDNYSNILYVMGMRPKLAFLAQLATSTDKFRPETCC
VVGNYYSLKSEHEKAVMYFRRALTLDRTFLSAWTLMGHEFVEMKNTHAAIESYRRAVDVN
RRDYRAWYGLGQTYEVMEMHSYALFYHQRAAALRPYDPKLWMAVGQCFGKVGKNMNGIRA
YKRALVAGSYYDHGVGSSFGSGEVSGLGGGVLDPEVLYQIALLYERIHNMAECASYMELV
LAQEDGPEYDEVGSEGTGGVGVTATTSKARLWLARWEYMRGMYQRAMELANELCQDGVEV
EDAKALVRDIRARQDSQRGDAGA
Download sequence
Identical sequences SNOT_15419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]