SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_16163 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_16163
Domain Number 1 Region: 109-496
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.93e-110
Family Cystathionine synthase-like 0.000000000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SNOT_16163
Sequence length 510
Comment | SNOG_16163 | Stagonospora nodorum conserved hypothetical protein (511 aa)
Sequence
MSNIAPTVARQALRIASRRYPSSTFSRFGPRAVAGQANGRRNYVSETKPSKATVHVDTTI
KAERKAFLDQTGERAQDATMPTTGLGADAMMSPSAGILKQASVMDQGSRPIYLDMQATTP
MDPRVVDAMMPFMTGLYGNPHSRTHAYGWETDKGVEDSREHIANLIGADPKEIIFTSGAT
ESNNMSIKGVARFFGRAGKKRHIITCQTEHKCVLDSCRHLQDEGFDITYLPVQNNGLVDM
AQLEAAIRPDTMLVSIMTVNNEIGVVQPVEEIGRLCRSKKVFFHTDAAQAVGKIPVDVNK
WNVDLMSISGHKIYGPKGIGACYVRRRPRVRLDPIISGGGQERGLRSGTLAPPLAIGMGE
AARICKEEMEYDTKRISALSNRLLTGLLSMEHTTLNGDRERHYPGCVNVSFAYVEGESLL
MALKDIALSSGSACTSASLEPSYVLRALGSSDESAHSSIRFGIGRFTTDEEIDYVLKAVQ
ERVSFLRELSPLWELVQEGVDLNTIEWSQH
Download sequence
Identical sequences Q0TWM9
XP_001806289.1.30160 SNOT_16163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]