SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SNOT_16534 from Stagonospora nodorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SNOT_16534
Domain Number 1 Region: 302-638
Classification Level Classification E-value
Superfamily TPR-like 1.14e-96
Family Tetratricopeptide repeat (TPR) 0.000000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SNOT_16534
Sequence length 638
Comment | SNOG_16534 | Stagonospora nodorum hypothetical protein (639 aa)
Sequence
MSFLGGAECSTGANPLSQFTKHVQDDKSLQRDRLVGRGPGGMHESMRSQQMGGGSDGMMN
EFMQQNAQLPQGPGPASPFAMEQMRRELERAQHSASPAWAAEFDPGMQAPQMGPSMQERP
AGFNPAEFAKFQQMSPNARTASPAAAEQPSMMGYQRPMYGMNSGMGMGMGMGMGMGGMGM
GMMPQNYSQQPAQSSAKGKERLVELDDKDWEAHFAELEQTDQNLDALDAEANKHIEAELN
EMDRSVDEFGDFESIWKGIQAETEYARQLANEESFVEGHMGDLDQWEGFDGLNTHSVRDP
AMGDYLFEQDNLFSNVTNPFDEGVKIMEEGGNLSLAALAFEAAVQKDPNHIAAWTRLGES
QAQNEKETPAIRALEHALKQDPSNLEALMGLAVSYTNEGYESTAYRTLERWLATKYPSLI
QEPLSSDAEMGFTDRHLLHEKVTNLFIQAAQLSPSGEQMDPDVQVGLGVLFYGVEEYDKA
VDCFGAALASTESGVSNSSSQVHLLWNRLGATLANSGRSEEAIDAYSRALALRPNFVRAR
YNLGVSCINIGCFTEAAQHLLGALAMHKVVEKEGKEKAREVVGDGVSDSQLDNMIHQNQS
TNLYDTLRRVFGQMGRRDLADIVGPGMDVERFRGEFEF
Download sequence
Identical sequences SNOT_16534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]