SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|30248413|ref|NP_840483.1| from Nitrosomonas europaea ATCC 19718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30248413|ref|NP_840483.1|
Domain Number 1 Region: 5-237,275-355
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.96e-56
Family ADP-ribosylglycohydrolase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30248413|ref|NP_840483.1|
Sequence length 360
Comment hypothetical protein NE0396 [Nitrosomonas europaea ATCC 19718]
Sequence
MSDKNIQDRAAGAIMGAFIGDALGLGPHWYYDLSELRRDYDDWITGYTDPKPDRYHAGLK
AGQLSQSGFILKLMVRSLVGCGGYDTEDFCHRMDEELFPLLDGTPVNGPGGYTSQSIRET
WRRRVQQMLPWGQTGGHADTTEAVERTLAIAVRYAYQPEQLAAAVSANTTLTQTDETIVS
MTVAYGAVLGLLIQGHALDTGLSGKLMDLVKSGALPFHAVTGDDLQPPRPGDPDPPRAGR
FASPDALLTPSYMAAAAVDPEIRIEPAWKVSIVYGMPCAIYHQLPAAYYLAARFRDDFKS
AVLHAVNGGGQNQARAMLTGALAGAQTGLSGIPQYLLDGLDNSAVLGKLAVELAASVNPI
Download sequence
Identical sequences A0A1I0AKK3 Q82X92
gi|30248413|ref|NP_840483.1| NeR10 WP_011111031.1.11244 WP_011111031.1.14462 WP_011111031.1.55826 WP_011111031.1.61914 228410.NE0396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]