SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54022038|ref|YP_116280.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54022038|ref|YP_116280.1|
Domain Number 1 Region: 68-247
Classification Level Classification E-value
Superfamily Rhomboid-like 1.22e-38
Family Rhomboid-like 0.0042
Further Details:      
 
Domain Number 2 Region: 4-45
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000801
Family B-box zinc-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54022038|ref|YP_116280.1|
Sequence length 286
Comment hypothetical protein nfa740 [Nocardia farcinica IFM 10152]
Sequence
MNDRPPTCVRHRDRATGLACTRCGRPACPECLRPAAVGQHCVDCVREGSAGVRPVRTVAG
APVARSATPLVTYGLIAVNLVFFAITAVQARSIVDNFQSPLFFRLALIPAYVADGEWLRV
IGSGFLHWGPLHLALNMFALYIIGIQLEPVLGRWRLLAVYLVALLGGSAGGMLLEPANTI
GAGASGAVYGMFGAIAVVIFRLRLNPTQILVVIGINVFLSLSLPGISLWVHLGGLLAGTL
ATLGVLFLPEWLGVRTSETARTVGWAAIAAVGVASVAAIAVAAAML
Download sequence
Identical sequences Q5Z3S5
WP_011206603.1.72093 WP_011206603.1.78782 WP_011206603.1.85486 WP_011206603.1.97239 247156.nfa740 gi|54022038|ref|YP_116280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]