SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54022649|ref|YP_116891.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54022649|ref|YP_116891.1|
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.17e-45
Family GpdQ-like 0.00012
Further Details:      
 
Domain Number 2 Region: 263-491
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000000183
Family Heme-dependent catalases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54022649|ref|YP_116891.1|
Sequence length 495
Comment phosphodiesterase [Nocardia farcinica IFM 10152]
Sequence
MILVAQVSDTHFDLGARNNERVERVMAFLADLAHRPDAILVTGDVTESGKPEQYAEARVA
LQADIPVWAIPGNHDERAAFRTELLGEQPSDSPINHVHRVGALTVIMLDTTIPGEPGGRI
EEDTYRWLREVLADAPATGPIVLAMHHPPARLHSPIVDDIALAEPDRLADVVAADPRIRA
VLTGHAHSAAATTFAGRPLLIAPSTASVLGGAWEVELPHRVMDYAPDPAVALHVFDESGA
MTTHFRTVPMGGFLGVAPVWAVAFGPAPTGHPADMTQPFRQIFAGAARLRHARVFHPNGL
RLSGRLHAEPEFESLFGTGERAVLARLSKGVGTPAGLPDVLGLALRVLDRDEQPFDLALA
TTGGGRLTRFVVTPARGWRSARYGSLLPYRFGSDAPVWLFAEPDAAQPESPALADLAAHL
RERPATFVLSARGFTGPPRRVAEVTLHPADAGDYRTDFFDPMANHPDEVRMLPEVVGRVR
ELAYSGSREGRGEPS
Download sequence
Identical sequences Q5Z214
247156.nfa6820 gi|54022649|ref|YP_116891.1| WP_011207214.1.78782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]