SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54024557|ref|YP_118799.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54024557|ref|YP_118799.1|
Domain Number 1 Region: 206-420
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-46
Family C-terminal domain of adrenodoxin reductase-like 0.00000622
Further Details:      
 
Domain Number 2 Region: 93-215,242-264
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.3e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00034
Further Details:      
 
Domain Number 3 Region: 10-68
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.46e-18
Family 7-Fe ferredoxin 0.0085
Further Details:      
 
Domain Number 4 Region: 398-550
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000812
Family N-terminal domain of adrenodoxin reductase-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54024557|ref|YP_118799.1|
Sequence length 554
Comment ferredoxin reductase [Nocardia farcinica IFM 10152]
Sequence
MAYVITQRCCNDASCVAECPVDCIRPRPEDPEFTSAEMLYIDPETCIDCGACFEACPVGA
VYAEDELPAQLDRYREINADWFARHPMTTDLPLPAPPARLPAHLGTLRVAIVGTGPAACY
AAEHLLAAGNVEVEMFDRLPTPWGLVRHGVAPDHGQTRAVAEMFAAAIKRDAVQLHLNVT
VGEHVAQAELLDSCHAVIYAVGASADRELGIPGENLPGSHSGTDFVAWYNGHPEHADLAV
DLSGERAVVIGNGNVALDIARVLTADPDELARTDIADHALAALRHSRIREVVVLGRRGPA
QAAYTGPEFLALAHLSGVDVIVDPADLAPGPGTAVPEGDDAARRKVALAHEYASAAVGSG
RRRIRFGYRAAPTAILGTDRVTGVEYARTRVRQTADGVVADRTEDRAHIEASLVLRATGY
RGVPVPDVPFDPERGIVPNAAGRVLDAPGGRPVPGLYVTGWIKRGARGVIGSNRGDSAET
VQALLADFRAGLLPTPAGDRTALTALIRTRQPDVVDRTAWQDIDRAERAAGAATGRPRVK
LTSVEALLAAARRG
Download sequence
Identical sequences Q5YWK6
gi|54024557|ref|YP_118799.1| WP_011209120.1.78782 247156.nfa25880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]