SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54024673|ref|YP_118915.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54024673|ref|YP_118915.1|
Domain Number 1 Region: 14-72
Classification Level Classification E-value
Superfamily ChaB-like 0.00000000000000115
Family ChaB-like 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|54024673|ref|YP_118915.1|
Domain Number - Region: 102-133
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0432
Family Rho termination factor, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54024673|ref|YP_118915.1|
Sequence length 142
Comment hypothetical protein nfa27040 [Nocardia farcinica IFM 10152]
Sequence
MEMPKTTRTGEAKKSELPSTLRRSEEKAQRTFAKAHDAALAEYGSEERAYRVGYSALKHS
YEKVGDHWEAKEQRGPSDERAEHGGPDAEGETAGGVNANASKKHLLDVAGRLGITGRWKM
TKHQLISAIEKENRRETARARS
Download sequence
Identical sequences Q5YW90
247156.nfa27040 gi|54024673|ref|YP_118915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]