SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54024676|ref|YP_118918.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54024676|ref|YP_118918.1|
Domain Number 1 Region: 15-534
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.27e-211
Family Heme-dependent catalases 0.0000000000237
Further Details:      
 
Domain Number 2 Region: 552-673
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.2e-21
Family Catalase, C-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54024676|ref|YP_118918.1|
Sequence length 719
Comment catalase [Nocardia farcinica IFM 10152]
Sequence
MTGHTPDTPDNAADADHAAGGADRKQRQLDAHRVDREQGHLTTQQGVRVRHTDDALSAGA
RGPTLLDDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDRLAEYTVAKFLTDPAE
RTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTSQGNYDLVGNNFPVFFIQDGIKFPDFV
HAVKPEPHNEIPQAASAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFR
FLDAAGTPTFVKFHWTPKLGVHSLVWDECQQIAGRDPDYNRRDLWDCIEAGHYPEWELGV
QLIPVEKEFDFDFDLLDATKLVPEEQVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVP
GIDFTDDPLLQLRNFSYLDTQLIRLGGPNFAQIPINRPVADVRNHQQDGYGQHAIPRGQA
SYTVNSIGGGCPVVGGDGSYEHYPRQVDGRAQRRRAESFREYYRQPRMFWRSMSAPEAEH
IVEAFAFELGKVQRVEIRERTLGQLVRIDPDLAVRVAGRLGLPAPPPDPEAGTDAFVSPA
LSQAHTAKDSIATRQVAVLAADGVDAAGVRALRSALTERGAIVEVIASHGGMVHADGGDG
DTLPVDRTLMTVASVLYDGVVVAGGQTGVETLTRNGEAVHFVLEAFKHAKPVAAFGAGVS
LLRIAGILDAARAHDADPATGVITTEARGDGLDEEFVTDLARALANHRTWQRATSAIPA
Download sequence
Identical sequences Q5YW87
247156.nfa27070 gi|54024676|ref|YP_118918.1| WP_011209239.1.78782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]