SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54024880|ref|YP_119122.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54024880|ref|YP_119122.1|
Domain Number 1 Region: 15-173
Classification Level Classification E-value
Superfamily PEBP-like 1.7e-50
Family Prokaryotic PEBP-like proteins 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54024880|ref|YP_119122.1|
Sequence length 175
Comment hypothetical protein nfa29110 [Nocardia farcinica IFM 10152]
Sequence
MAYNPYDALPQVPTFTVTSQDVTDGQPFASEQVSGVMGAGGKDISPQLSWSGFPPETKSF
AVTVFDPDAPTASGFWHWAVCDIPADVTSIPSGAADNDAGLPTGSLTLRNDAGSYGYVGA
APPPGHGPHRYFIVVHAVDTERLGLDKNTTPAVLGFNLFSHTLARGTIVATYEQK
Download sequence
Identical sequences A0A2A7UBZ9 Q5YVN3
gi|54024880|ref|YP_119122.1| WP_011209443.1.31130 WP_011209443.1.78782 247156.nfa29110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]