SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54025756|ref|YP_119998.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54025756|ref|YP_119998.1|
Domain Number 1 Region: 114-372
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.39e-40
Family Spermidine synthase 0.0022
Further Details:      
 
Domain Number 2 Region: 10-121
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 2.39e-31
Family Bacterial S-adenosylmethionine decarboxylase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54025756|ref|YP_119998.1|
Sequence length 406
Comment S-adenosylmethionine decarboxylase [Nocardia farcinica IFM 10152]
Sequence
MSLPMTAEFTGWHVLAEFGGVDAALCDDLERLESALRESLIAAGVTICDVVHKKFEPQGV
TVLALLSESHASIHTYPESGDIFVDVFTCGSIGAGATKAVELLRDALAPANVRMQVIQRG
HGAQRIEEPVGAGLTRIWDLQDVIVDTHTPFQHMVIARTEQGISLFSDDDRQSTEFSQLT
YHEAMMVPAFVLAEKLDTVLIIGSGEGVASQMSVAAGATHVDHVDIDQLEVELCAQHLPY
GYTSEELAAAVRGEGPITVHYADGWDFLEQAQQAGTRYDVIVIDLPDERVEDAQHNRLYE
AEFLSRCRALLAPGGVLSAQAGCATMWRNETLKRSWQRFHEQFGTVVHYGSDEHEWSFLF
GLVDEIADPVPGMVDRLATLPYRPETIDGRALVRGAIEPHALRASR
Download sequence
Identical sequences Q5YT57
gi|54025756|ref|YP_119998.1| 247156.nfa37860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]