SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54025794|ref|YP_120036.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54025794|ref|YP_120036.1|
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily YaeB-like 0.000000000000144
Family YaeB-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54025794|ref|YP_120036.1|
Sequence length 52
Comment hypothetical protein nfa38240 [Nocardia farcinica IFM 10152]
Sequence
MLRIDGLDLHVAELDAVDGTPVLDIKPWFAEFGPRGEVRQAAWATEMLRDYF
Download sequence
Identical sequences Q5YT19
gi|54025794|ref|YP_120036.1| 247156.nfa38240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]