SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54026160|ref|YP_120402.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54026160|ref|YP_120402.1|
Domain Number 1 Region: 4-154
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.56e-44
Family Adenylyltransferase 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54026160|ref|YP_120402.1|
Sequence length 161
Comment phosphopantetheine adenylyltransferase [Nocardia farcinica IFM 10152]
Sequence
MAGALCPGSFDPVTNGHLDVFTRAAAQFDEVVVTVMINPNKKGMFDVEERMELLRETTAH
LPNVRVASWRGLLVDFAREQGITAIVKGLRDATDFGYELQMAQMNKKLSGVDTFFIATNP
AFSFLSSSLVKEVATYGGDVSDMLPPVVHKRLLDRIAERRG
Download sequence
Identical sequences A0A0H5PMZ2 A0A2A7UF74 Q5YS03
WP_011210723.1.31130 WP_011210723.1.72093 WP_011210723.1.78782 WP_011210723.1.85486 WP_011210723.1.97239 gi|54026160|ref|YP_120402.1| 247156.nfa41890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]