SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54027513|ref|YP_121755.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54027513|ref|YP_121755.1|
Domain Number 1 Region: 8-504
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 9.42e-187
Family Heme-dependent catalases 0.00000000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|54027513|ref|YP_121755.1|
Sequence length 553
Comment catalase [Nocardia farcinica IFM 10152]
Sequence
MTDVASQGAAQGDDRRVLTNRQGHPVFDNQNQRTVGARGPATLENYQFLEKISHFDRERI
PERVVHARGAVAYGYFEATGKWGDEPIENYTRAKIFAEAGKRTDLAIRFSTVIGGRDSSE
AARDPRGFAIKFYTEDGNWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFD
FMSQTPEAMHMLVNLFSPRGIPANYRTQQGFGVNTYKWVNAEGVTHLVKYHWIPKAGVKS
LTEADAAAIQAQDLGHASKDLYEHIEAGDYPEWELRVQIMSDDEHPELNFDPLDDTKVWP
ENEFPPKPVGKMVLNRNVSNHFLENEQISFGTGVLVDGLDFSDDKMLVGRTFSYSDTQRY
RVGPNYLQLPVNQAKNAHVATNQQGGPMAYGIDDVGENPHVNYEPSITGGLREAQYPTHD
EQGPEIRGRLTRKRIPRTNDYEQAGQRYQLMEQWEKDDLVTNLVANIGQATREVQERMVW
HFYMCDDELGERVGQGLGISADDVRGLPPLQSQTLSDEELQRAANLGKNGPRDVEGLQMT
HCVPDEREVHAAA
Download sequence
Identical sequences A0A2A7UIN5 Q5YN50
gi|54027513|ref|YP_121755.1| 247156.nfa55390 WP_011212073.1.31130 WP_011212073.1.78782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]