SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54025491|ref|YP_119733.1| from Nocardia farcinica IFM 10152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54025491|ref|YP_119733.1|
Domain Number 1 Region: 122-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.3e-61
Family D-glucarate dehydratase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-34
Family Enolase N-terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54025491|ref|YP_119733.1|
Sequence length 367
Comment muconate cycloisomerase [Nocardia farcinica IFM 10152]
Sequence
MKITRVEAIPFAIPYRKPLRFASGEVHTAEHVLVRVHTDDGVVGVAEAPPRPFTYGETQD
SIVAVIRKLFAPQVVGLTLLQRETVAARLARTVGNPAAKAALDMAIWDALGRTLDVQVTE
LLGGYTDRLRVSHMLGFDDPAAMVAEAQRMRERHGITTFKVKVGRRPIGLDLAVVRALRE
GLGEEVELYVDGNRGWTASESARAMREMADLGLLFAEELCPADDVLGRRWLVSQLDVPFI
ADESVPTPADVTREVLAGSATAISIKIARTGFTGSQRVHHLAEGLGLEVVMGNQIDGQIG
SLCTVAFGAAFPLTSRRAAELSNFLDMSDDLLTEPLDIRGGELTVRPGAGHGAEIDPDKL
ARYRQDR
Download sequence
Identical sequences Q5YTX2
gi|54025491|ref|YP_119733.1| WP_011210054.1.78782 247156.nfa35210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]