SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGUT_03715 from Candida guilliermondii ATCC 6260

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGUT_03715
Domain Number 1 Region: 55-163
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.5e-37
Family Frataxin-like 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGUT_03715
Sequence length 172
Comment | PGUG_03715 | Candida guilliermondii hypothetical protein (173 aa)
Sequence
MFRQAIRRFHGVGRTTRGTTRLVQVPLRRQGWPITNAPGMIGGRFYSINTEGEDISDSID
KISIGEYHRVADEYLETLADELETLAEDNPQVDAELSHGVLTLVLPPYGTYVINKQPPNQ
QIWLSSPVSGPKRFDLIKSRWITLRDNSSLTETLETELSSALGNETKLDVQQ
Download sequence
Identical sequences A5DKB4
XP_001484334.1.35779 PGUT_03715 4929.A5DKB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]