SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000145 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000000145
Domain Number - Region: 90-100
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0811
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000145   Gene: ENSACAG00000000150   Transcript: ENSACAT00000000148
Sequence length 677
Comment pep:known_by_projection chromosome:AnoCar2.0:4:139295513:139327114:1 gene:ENSACAG00000000150 transcript:ENSACAT00000000148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRAVSRGAAETPSLPLGERPGRPRGGGRKRKPPPGELEGCKRAKTGQQANTTTTTTM
VLGPAQAEPLPAVTTTTAGLFTFASLSLSPPPPLPPQPPPQAPRCERRHHHRHRHRPPDR
GSGSGASSAEKAHKGRRGSVGEGRPGKRESRDENGKTQRADSLIVKKIKKKKKKKHREDT
RGRHLKMYNKEVQTVCAGLTRINKEILTPGENDNLEENKESFRYLKDEQLCQLNLGVQEY
RIPQGVQSPFTTHQEHSVRNSFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPVE
IERFAEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKD
IETTTISNFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLRMT
LPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNEIKNLQYLPRT
SEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFGEWSDQPRITKDVVCFHAEDF
TDVVQRLQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFK
TVSAVCSLAWHIRLKQYYPAGENSQSTDGISNMDSTTHDEMLSEENKCLLVKEEPEEVGR
DVQTATMPQPLLFSSLS
Download sequence
Identical sequences G1K8C1
ENSACAP00000000145 XP_003220630.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]