SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000353 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000000353
Domain Number 1 Region: 126-339
Classification Level Classification E-value
Superfamily ARM repeat 8.96e-26
Family Diap1 N-terninal region-like 0.021
Further Details:      
 
Domain Number 2 Region: 738-818
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000000628
Family Formin homology 2 domain (FH2 domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000353   Gene: ENSACAG00000000374   Transcript: ENSACAT00000000367
Sequence length 1243
Comment pep:novel scaffold:AnoCar2.0:GL344157.1:13212:62717:1 gene:ENSACAG00000000374 transcript:ENSACAT00000000367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQEEAEEEAALAAVWIRLQFLEDGEPFAGAPFPEPRRPPALALDPARTLAAQLPLLHRH
LQAPLPLEDCALQVLPSGHYLDLEQSLLEQKDELEGFFEDVSKGRRPILLLRTQLSVRVQ
AILDKLYTAKGPELRRSLFSLKQLFQEDKDLVPEFVSLGGLTCLIAVGAEADQNYQNYIL
RALSQIMLFVDGMMGVIGHNATVQWLYTLCGSLYRLVVKTALKLLLVFVEYTESNAQLLI
QAIAAAEQAKGGLPWSPLVAILEPDSGSDSELQVFAMTLINKTLAALPDQDSFYDVTDCL
EQQGMERIITQHMAGKGTDPGLRHQLTIYESSLRYEDGLEETPEGPPGKERRKGEDGRRG
PRRSLGYVSVLAASAVESGSSQHPPVAAKVEKEELQTTHSSVSSVSGLQLSSLLVGPVEG
GGGCSGGETPTSLGERSVFKARFLENLAASQKEKLIAISQGRAEVLAEATPSPEQLGPDV
EVGTSDLHDKQRVGRPVTATTKFHNTDLKFARNSSHVTRMKVTPFSFGVTPSAAKNSVTV
LCLSCIDRPSAQGSILCALTTQPFNAKASLSAWFHTSYFNNTTVQCQMELTVEESQLNKP
VPATEQDCHLLRSYPELLAITPASLSSGKWSEGAAQGANEEEPRTPSLAGSCDDTEVEEP
PPAARCPPPLRTPTPPEKKGPQCQHQQHSPPWTQTPLLHAEESRGRLLEEEKEDSRSGRR
PVAGRPGNLDAESSLQSLERDTAGPLRHLFMERKSRVATPKKAADGKKLLVVLDPKRSNA
INIGLTVLPPIHIIKQAILNFDEFAINKEGIESLIKMLNRTGPRTEPCGTPLVTSFHDED
DALVSTLWVRSLSQLQIHLTVVLSSPHFTSLFARRSWGTLSKALLKSRYATSTAFPVSTQ
LVTLSKKEVLKPRGYSVPYNLQIKHHSLSIHLSNHTYIYLAGVTLKNVPVPMYIQIQLKN
RTYLILFSRISNAVLTTQCFAISEEDMRLRLYEKYDHTIKKCKYANINTELNNRIKILQS
KSIKIYSKQLYIHTIYYFISIAQYYYTIMVLYTICNIISNVTSQYKYSRVLLIQHKRAGR
TLDKRICRIMRQMERFSTGQKVEDDPPPAVLSTRLQQKDEAGHQSMASILIAPSEPSGRR
SRGSRGFSKQSPPSVVPAQPQEGEGEEEPPRVAPTSGPSEEEEEIMDRLVKSVTQSSPAR
PGAGKERKRSRLNRKSLRRTLKNGLSDELVQALGLAKAAGVTV
Download sequence
Identical sequences H9G3M3
ENSACAP00000000353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]