SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000483 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000000483
Domain Number 1 Region: 229-470
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.07e-57
Family Decarboxylase 0.000000462
Further Details:      
 
Domain Number 2 Region: 6-198
Classification Level Classification E-value
Superfamily PRTase-like 3.41e-43
Family Phosphoribosyltransferases (PRTases) 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000483   Gene: ENSACAG00000000507   Transcript: ENSACAT00000000501
Sequence length 476
Comment pep:novel scaffold:AnoCar2.0:GL344627.1:16557:26907:-1 gene:ENSACAG00000000507 transcript:ENSACAT00000000501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALASALHAAKALRFGEFLLKSGLVSPVYVDLRVTASEPSLLNKVADLLFQTAEDAKLQ
YDSVCGVPYTALPLATIICSTKQIPMLIRRKEAKDHGTKRLVEGTINPGETCLIIEDVVT
SGSSVLETAEVLRKEGLQVTDAIVLLDREQGGKAVLKKHGIRLHSVYALSQILKILEQQQ
KVSPEMVARVEKFIRENIVEPSEQKGLAPTKRICKEMSFAARAELPGIHPLAAQLLRIME
KKQSNLCLSADVTTSKELLQLADILGPSICILKTHIDILGDFSQEVVKELRKFADQHEFL
IFEDRKFADIGNTVKHQYEGGIFKIASWSDIVNAHAVPGPGVVKGLKEVGNPLQRGCLLI
GEMSSEGSLATGDYTKAVVKMAEEHADFVLGFISGSRIAEKPEFLHLTPGVQMQTGSDNL
GQKYLSPQELIGKRHSDIIIVGRGILSACNQAEEAEAYRKLAWESYLQRIGVGAQM
Download sequence
Identical sequences H9G3U6
XP_003230284.1.98722 ENSACAP00000000483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]