SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000624 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000000624
Domain Number 1 Region: 63-183
Classification Level Classification E-value
Superfamily PX domain 9.81e-32
Family PX domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000000624
Domain Number - Region: 234-304
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000624   Gene: ENSACAG00000000581   Transcript: ENSACAT00000000644
Sequence length 473
Comment pep:known_by_projection chromosome:AnoCar2.0:4:92664046:92729389:1 gene:ENSACAG00000000581 transcript:ENSACAT00000000644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEGGDVAGDSTGLLLLDLYDDEDLEVFSKDASLTEINSFSPLMPTSPSSMINQYKFED
EPESKDLFITVDDPESHVTAIETFITYRVVTKTTRGEFDSSEYEVRRRYQDFLWLKGRLE
EAHPTLIIPPLPEKFIMKGVVERFNDKFIETRKKALHKFLNRIADHPTLTFNEDFKIFLT
AQAWELSSHKKQGPGLFSRMGQTVKAVASSMRGGAVKNRPEVFSEMIEYVDIFSQKISLL
DKISHRVHKEEKDYLYEMKEFGPIHTLWSASEEDLVDTLKGLAGCIDQCCKATEKRMTAL
SESLFPAIQEYLLYSEILMGVLKRRDQIQAELDAKIDAVYNKKIENELLSEEIGKLEDKV
ECANNALQADWDRWKQSMRVDLKMAFSDVAENNIHYYEQVPLPADFCCQSVEPHLAVPSY
LGVLLDISSNIRHFLGRTIRRSDLTSSYKDPSSLLDIDTSQRNYLIIKSNYPI
Download sequence
Identical sequences G1K8N3
ENSACAP00000000624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]