SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001223 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001223
Domain Number 1 Region: 199-338
Classification Level Classification E-value
Superfamily PH domain-like 5.66e-44
Family Third domain of FERM 0.000000177
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-39
Family Second domain of FERM 0.000000661
Further Details:      
 
Domain Number 3 Region: 502-589
Classification Level Classification E-value
Superfamily Moesin tail domain 6.54e-33
Family Moesin tail domain 0.0000218
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-26
Family First domain of FERM 0.00000747
Further Details:      
 
Domain Number 5 Region: 473-482
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000251
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000001223
Domain Number - Region: 434-480
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.000523
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001223   Gene: ENSACAG00000001083   Transcript: ENSACAT00000001256
Sequence length 600
Comment pep:known_by_projection chromosome:AnoCar2.0:3:186411969:186449397:-1 gene:ENSACAG00000001083 transcript:ENSACAT00000001256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYTTWLK
LNKKVTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHGDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKDELLERLRQIEEQTMK
AQKELEEQTRRALELDQERKKAKEEAERLEKDRRAAEEAKAALAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPPPP
PPPVLPQTENEHDEQDENHAEASAELASDDAVNHRNEEERVTETQKNERVKKQLQALSSE
LAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMLQNYDHLQPLG
Download sequence
Identical sequences G1K9A4
ENSACAP00000001223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]