SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001814 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000001814
Domain Number - Region: 35-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001814   Gene: ENSACAG00000001898   Transcript: ENSACAT00000001858
Sequence length 491
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343879.1:100413:116525:-1 gene:ENSACAG00000001898 transcript:ENSACAT00000001858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSATILFSPPNAKEAKCCCCTCKQEPAAQTSAPPPLPPPPSPPCTPITVTGSGLALQS
PDQLLHIIYQRVEKAASLAEVALSLAKANNEALKRLEEDVGALRRGTPPSLKASPPCVPE
EHQEDAEGEEEEEQEAEGFGNGVQVVIEELRQLGAAAGPPGHLGFSPVQLGTGSGGLAGV
AENSSAGDASMQRVYATPSSPTPHESALQSLDDSLSYAEVSPNSTTLEDSMHGEPRFSLG
FASLPSRSRSSGQKNARRKRDLVLSKLVHNVHNHVTNDKRFDGSESIKSSWNISVVKFLL
EKLKQELVSNQHNYTDKELKGACVAYFLTKRREYRNSLNPFKGLKEKEEKKLRSRRYRLF
ANRSGMARLLSPEDQCMWQSVTEELMSDEEDSMSEPGVWVARPPRFRAAPLTRLCYRLDA
NSKHGTKANRVYGTPSDRLPSAEVQLLPQHLYNPHFQEDESKAGTSPHPPSHKSFCPDLS
SFVEIKVEKDE
Download sequence
Identical sequences H9G5Q1
ENSACAP00000001814 XP_003229374.1.98722 XP_008121560.1.98722 XP_008121562.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]