SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001989 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001989
Domain Number 1 Region: 18-27,105-110
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000034
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001989   Gene: ENSACAG00000002088   Transcript: ENSACAT00000002037
Sequence length 3013
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343366.1:235437:303423:1 gene:ENSACAG00000002088 transcript:ENSACAT00000002037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSSAAASPPAQHPPPPPPPPPPPPPEPQPQPPPPLPQSPSATAEPELVSLILNRLKS
QGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVSNHLATHTWSPHLNKNQLRNNIRQQVLK
SGMLESGIDRIISQVVDPKINHIFRPQVEKAVHEFLATLNHKEETSPSIAPPEEKPDVSV
LMQGVSSTIPSASVANDAMSILETITSLNQEANAARASTEAANVKTNDRISKRVLSQLSV
DGTTEKDRNTDVLLDEEKPPYNSMEESFESVANSEDVTNLFSSSEEGKTVSKDMINVVNP
VKEIVQESEEQKSKPIDKYDKKPEHIEKGEKRKEKKEKPEKKLDLSKKAGDDLKGKEEKT
EKDKETELLKCLVLEKSSSKHKGNGSTKEALEDSDIDVLSDITVSSVHTSDLSSFEEESE
DEVALSDSTEEGEIVSDDEEKEQNQVKTQSEAGMSDDKKLKSGRHAYVHKPYLYSKYYSD
SDDERTVEQRRLSVAKEKEERLLKRHLNREKLEEKRKQKAAEKTKMLKTGNQVKSIQNLE
ESSSKGLEQKASGASIKDALKEQRFLEKKAALSRKRKRESRHDEEGRKKKHEQPEEDLEE
PLKINESGEKAKEVKASQGKTEGNKLVKKLPESVHITDENRSDSKIEKEHKRKTSSSFQM
EGIQQDGELCDTKSQIDKAENNPEESQKQRTVFKTEKHIKKDDSETQNVKTVPKKEARSS
KDRNEKERSISEDKSLIKHKYKGDGVHKTAEEVECLPSQRGLKSEENFQKYNQLLRTLSD
DKAERKNKHRSERKTSVSSKDVKTVSDHTSRNEENTRKESNRKDRPASTDKLRTEHKSKR
LLSDSRPPKESQSISKQHSSATSRKSESSSEDKHDADSSNLDNNLKQSDSIQKDRRKSKS
ASEERLSLKSKSKSHSKVIKVPENESQNSSSKQESVQKLDKDKNTEENDIDKQGKSRSEI
KVFEENSIELELESEAHSVSSSQKDFSHRFKSAEKSSVKEKTKSDKDLGSARLEKKLSAE
GHKSRSVRHVSKETKKREDDNKPVDKSVKQTENYTKMQENSPYTDKRLTKRISSENRKGS
VSSQEIDVRGEKLVTSVAVPIPALQKTECTSGHSLHSEQSQEQVEVESEQRHGNAHHHIE
GERSHNSQQATKCKISAKDQVHHNSTNEFTETLHTKELSKSSLSGVVNPKQKELFSTKEI
STQNDTFKQSSKNVGSSKQKQCRAIVENETSDKVLLHSSPKENAKLQFQTITEDVHTSKN
VKNTITLSEESSPPTNISSREDVIHQKSMDKDLGEVMVPLSCTSKEKSFNFDGPCMKNTI
SDHQIPMVKTEQKNIIELSSNIKYGDNTNMDVISADGKSHLSCPEAPEENVSSLSGIQEA
VVQERTKSSLADTIKNESFCGPAIQVTHVSVDNFAITILEEGKDSSGPSAKNNEDAIEGK
IETKESNNAYDITELSSRSIPENVPEDINKVSAIVNEAEGKGGDTRPQSDNSVVGSSVGG
SNCVSTCSGMEIDALVIGTSTERTVGSAVTASSTEGELRKEGVSNLQRERDATITCSEEN
SKTTLSCTSIEADEGFIVGTWTKNKEGVHFEREKCFGECTVTAAEESGSITEGLSVCESS
STTTKEGESAECIVNYAEEGTKQFFNQSGIERDQSMNSFTVEEKDDAVTSAGSEERCMAS
VSGGTSTFGSVVICTGELESDGAVTSAGTEAQNGSMITGNQDECQNNATGTEQVKGAEGA
VTCTGTVGANVFSAICSVTGTDSQEEGVVTGVFAESDNHVATGPHADKSEDIINGESAVT
STGITREDDPEAAPACAGLEDSNEGFAAASDTEEKYNNATFSTEDRTEENVLEFTQSSYD
DERCVTSTGAKEEDEEGENFVTSTGRDNEETENTLACTGTDESERVLVCVEATASVSQAV
SQAGERLDELNSNTDKDAVGSMMDLEKEMTTGDISNSTKGVVESSTTSTDPGNQHIMSAV
VRKEGSLLAEKFKCDMISATSNTQSIDELSAGEGKSESTTSYLDGEECESLFKVISKKVT
IPQASANQDDKDEGETISTSVVKVCPNPIHCSTEEHSEQKSAHEVANRDETTCLIDAEDF
SVPMPSTSVECMRPGPAVESSKGPTSILEDFEAPMPSLTVEDDKSLFAAVKSEMTTSLGV
NAVSNPIVSAGRSSESYIVEGKEERDECSVISTSIIDETEMPISQEDTESDAQRVALRVE
QSTDTTVISTSSTENVETSVFSTETDAVNQVPSTDRKLETSTITTTEGCHQATRDNLVPI
EAKERNGDTMGETEECKAVQEVGSQKSDLLVQSTEKINQNDTDLTQERTDYEAHQLIIDN
TKPDQRLATLSIENPGNSTKISVRTMTECDSVSTIGASEESTPVASEKTPLSFASIEVED
EKKIAVVASESDCNMLPAPENNEISSAVIHRDSQKLQKGETDGALEESAPSKNSNTEDIE
IPSNTVKSVIGGTDLYLNSLVSDGSSMEATKQENGTQDSRQHTEDSSSPSGIPQEKEKGN
ENLETDDVNLNTELKTGLPETRDSPNKESSMTLLQNSEDRKVLDSKTNLCSQYGLASKNV
KVEEHHNPEAFSHGSKVDNNGNKEMLAVTAEELEENTKLRADEGMRNTVLEHLCAKDHPE
DILKEHDCSDILVVTEAVEDKGPKENSLQLEISNQKEEYSIPESAKSPAAGNSESDHDPV
CQTLEETDEQTTDVETKPKINMEATIIDSEEKLEAGANSQEPSLESVNEKDEKAVKVDSF
GKTDLESKTNSTEVNPPVKRKRGRPRKHPIEIKVVEGQELEADTSPGNTMKTSGPNSKQK
TTPKGKDSLTENQRQSETEEEKTEVVLSRRGRKPKRPLIPSEETGMDSPEPDRKRLKLAP
AVQEETKDHDGRKESSGVGRNDNGDNSGSDADEMHSGATTRAASRLEAQRKQPSKPTTRA
AAKNQSPDPVPPRKRKRVVDKKESSATAKSNKSPISAHSKLQSPRHKKEVRPLMSHKKSH
PRANEPEAKKSKR
Download sequence
Identical sequences H9G5W5
XP_008117288.1.98722 ENSACAP00000001989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]